| Acinetobacter genomosp. 3 |
| Accession Number: |
AF369871  |
| Source: |
Clinical isolate - Korea |
| Journal: |
J. Antimicrob. Chemother. 49 (5), 837-840 (2002) |
| Published: |
17-MAY-2001 |
| Title: |
Molecular characterization of metallo-b-lactamase-producing Acinetobacter baumannii and Acinetobacter genomospecies 3 from Korea: identification of two new integrons carrying the bla(VIM-2) gene cassettes |
| Authors: |
Yum,J.H., Yi,K., Lee,H., Yong,D., Lee,K., Kim,J.M., Rossolini,G.M., Chong,Y. |
| Remarks: |
|
|
|
Gene:
agaaaaccgaggatgcgaaccacttcatccggggtcagcaccaccggcaagcgccgcgacggccgaggtcttccgatctcctgaagccagggcagatccgtgcacagcaccttgccgtag
aagaacagcaaggccgccaatgcctgacgatgcgtggagaccgaaaccttgcgctcgttcgccagccaggacagaaatgcctcgacttcgctgctgcccaaggttgccgggtgacgcaca
ccgtggaaacggatgaaggcacgaacccagttgacataagcctgttcggttcgtaaactgtaatgcaagtagcgtatgcgctcacgcaactggtccagaaccttgaccgaacgcagcggt
ggtaacggcgcagtggcggttttcat
|
Protein:
MKTATAPLPPLRSVKVLDQLRERIRYLHYSLRTEQAYVNWVRAFIRFHGVRHPATLGSSEVEAFLSWLANERKVSVSTHRQALAALLFFYGKVLCTDLPWLQEIGRPRPSRRLPVVLTPD
EVVRILGFL
|
|
|