| Pseudomonas aeruginosa |
| Accession Number: |
AJ584652  |
| Source: |
clinical sample (lower respitatory tract) - Brazil:Brasilia |
| Journal: |
Antimicrob. Agents Chemother. 48 (12), 4693-4702 (2004) |
| Published: |
04-OCT-2003 |
| Title: |
Integron carrying a novel metallo-beta-lactamase gene, blaIMP-16, and a fused form of aminoglycoside-resistant gene aac(6')-30/aac(6')-Ib': report from the SENTRY Antimicrobial Surveillance Program |
| Authors: |
Mendes,R.E., Toleman,M.A., Ribeiro,J., Sader,H.S., Jones,R.N., Walsh,T.R. |
| Remarks: |
|
|
Gene:
gtgaccaacagcaacgattccgtcacactgcgcctcatgactgagcatgaccttgcgatgctctatgagtggctaaatcgatctcatatcgtcgagtggtggggcggagaagaagcacgc
ccgacacttgctgacgtacaggaacagtacttgccaagcgttttagcgcaagagtccgtcactccatacattgcaatgctgaatggagagccgattgggtatgcccagtcgtacgttgct
cttggaagcggggacggatggtgggaagaagaaaccgatccaggagtacgcggaatagaccagtcactggcgaatgcatcacaactgggcaaaggcttgggaaccaagctggttcgagct
ctggttgagttgctgttcaatgatcccgaggtcaccaagatccaaacggacccgtcgccgagcaacttgcgagcgatccgatgctacgagaaagcggggtttgagaggcaaggtaccgta
accaccccagatggtccagccgtgtacatggttcaaacacgccaggcattcgagcgaacacgcagtgttgcctaa
|
Protein:
MTNSNDSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQSLANASQLGKGLGTKLVRA
LVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRSVA
|
|
|