| uncultured bacterium |
| Accession Number: |
DQ282237  |
| Source: |
dry forest soil - Puerto Rico: Mona Island (42 miles from the west coast of Puerto Rico) |
| Journal: |
Appl. Environ. Microbiol. 75 (15), 5100-5110 (2009) |
| Published: |
08-MAR-2006 |
| Title: |
Worldwide prevalence of class 2 integrases outside the clinical setting is associated with human impact |
| Authors: |
Rodriguez-Minguela,C.M., Apajalahti,J.H., Chai,B., Cole,J.R., Tiedje,J.M. |
| Remarks: |
|
|
|
Gene:
cgggttaaggatgtggattttggctatgggcagatcacggtgcgcgacgggaagggagcgaaggatcgggtgacgatagtgccgaggaacctggcggagccgctgcggcgacatgtggcg
cggatgaaagcgcaacacgagcaggacctggaggagggtttcggagcggtctcgattcccggggcgctcgcgcgcaagtatccaaacgcgcaaagggaatgggcctggcagtttattttt
ccctccagccggacctcgcttgatccacggcgaccggcgtgggatcagctgccgtgccggcatcatgtggcggagagcgctttacagacggcggtgcgagaagcggtgcgcgcggcgcag
gttgcgaaacgggcgacctgccacacgctgcgtcactcctttgccacgcacctgctggagaatggctacgacatccgcacggtgcaggagttgttagggcaccgggaggtggccacgacc
atgatctacacgcatgtgctg
|
Protein:
RVKDVDFGYGQITVRDGKGAKDRVTIVPRNLAEPLRRHVARMKAQHEQDLEEGFGAVSIPGALARKYPNAQREWAWQFIFPSSRTSLDPRRPAWDQLPCRHHVAESALQTAVREAVRAAQ
VAKRATCHTLRHSFATHLLENGYDIRTVQELLGHREVATTMIYTHVL
|
|
|