| Pseudomonas aeruginosa |
| Accession Number: |
DQ522236  |
| Source: |
Russia |
| Journal: |
Unpublished |
| Published: |
31-MAY-2006 |
| Title: |
Characterisation of class 1 integrons carrying the genes for VIM- and IMP-type metallo-beta-lactamases in Pseudomonas aeruginosa strains from Russia |
| Authors: |
Shevchenko,O.V., Edelstein,M.V. |
| Remarks: |
|
|
|
Gene:
ggatgcgaaccacttcatccggggtcagcaccaccggcaagcgccgcgacggccgaggtcttccgatctcctgaagccagggcagatccgtgcacagcaccttgccgtagaagaacagca
aggccgccaatgcctgacgatgcgtggagaccgaaaccttgcgctcgttcgccagccaggacagaaatgcctcgacttcgctgctgcccaaggttgccgggtgacgcacaccgtggaaac
ggatgaaggcacgaacccagtggacataagcctgttcggttcgtaaactgtaatgcaagtagcgtatgcgctcacgcaactggtccagaaccttgaccgaacgcagcggtggtaacggcg
cagtggcggttttcat
|
Protein:
MKTATAPLPPLRSVKVLDQLRERIRYLHYSLRTEQAYVHWVRAFIRFHGVRHPATLGSSEVEAFLSWLANERKVSVSTHRQALAALLFFYGKVLCTDLPWLQEIGRPRPSRRLPVVLTPD
EVVRI
|
|
|