| Brachymonas denitrificans |
| Accession Number: |
EU434611  |
| Source: |
antibiotic production wastewater treatment plant and the receiving river - China |
| Journal: |
Unpublished |
| Published: |
26-FEB-2008 |
| Title: |
Composition and Characterization of Bacterial Communities in Antibiotic Production Wastewater and the Receiving River Using Culture-dependent and -independent Techniques |
| Authors: |
Li,D., Zhang,J., Yang,M. |
| Remarks: |
|
|
|
Gene:
tcaatgtgcgctgaccttggatagcaggtttagaacggcgacgccactgacgataagtcccatgccaatgaacgcccagaagtctagtttttggccatggaaaatccaagcaatagctgc
cacaagcacgatgccaagcccagcccatacagcgtaagcaataccgaccggaatggacttgagcgcgagagacaagaaatagaacgcaagcccgtagccagccacaactacaacggaagg
aactaacctagtgaatccatggctagacttcagtgcggaagttgcgatgacctcgccaaagattgcaacagccagaaatatccagttcttcac
|
Protein:
MKNWIFLAVAIFGEVIATSALKSSHGFTRLVPSVVVVAGYGLAFYFLSLALKSIPVGIAYAVWAGLGIVLVAAIAWIFHGQKLDFWAFIGMGLIVSGVAVLNLLSKVSAH
|
|
|