| uncultured bacterium |
| Accession Number: |
FM866492  |
| Source: |
Tar Pond - Canada:Cape Breton, Sydney Tar Ponds |
| Journal: |
Unpublished |
| Published: |
01-DEC-2008 |
| Title: |
A new pool of integron gene cassettes encoding homologs of xenobiotic degrading proteins |
| Authors: |
Koenig,J.E., Sharp,C.E., Dlutek,M., Boucher,Y., Curtis,B., Joss,M., Doolittle,W.F. |
| Remarks: |
|
|
|
Gene:
ctggatttcgatcacggcacgatcatcgtgcgggagggcaagggctccaaggatcgggccttgatgttacccgagagcttggcacccagcctgcgcgagcagctgtcgcgtgcacgggca
tggtggctgaaggaccaggccgagggccgcagcggcgttgcgcttcccgacgcccttgagcggaagtatccgcgcgccgggcattcctggccgtggttctgggtttttgcgcagcacacg
cattcgaccgatccacggagcggtgtcgtgcgtcgccatcacatgtatgaccagacctttcagcgcgccttcaaacgtgccgtagaacaagcaggcatcacgaagcccgccacaccgcac
accctccgccactcgttcgcgacggccttgctccgcagcggttacgacattcgaaccgtgcaggatctgctcggccattccgacgtctctacgacgatgatttacacgcat
|
Protein:
MDFDHGTIIVREGKGSKDRALMLPESLAPSLREQLSRARAWWLKDQAEGRSGVALPDALERKYPRAGHSWPWFWVFAQHTHSTDPRSGVVRRHHMYDQTFQRAFKRAVEQAGITKPATPH
TLRHSFATALLRSGYDIRTVQDLLGHSDVSTTMIYTH
|
|
|